FHL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134901
Artikelname: FHL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134901
Hersteller Artikelnummer: orb2134901
Alternativnummer: BYT-ORB2134901-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FHL2
Konjugation: Biotin
Alternative Synonym: DRAL, AAG11, FHL-2, SLIM3, SLIM-3
FHL2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 963849
UniProt: Q14192
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC