CBX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2135054
Artikelname: CBX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2135054
Hersteller Artikelnummer: orb2135054
Alternativnummer: BYT-ORB2135054-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBX1
Konjugation: Biotin
Alternative Synonym: CBX, M31, MOD1, p25beta, HP1-BETA, HP1Hsbeta, HP1Hs-beta
CBX1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 006798
UniProt: P83916
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN