KIF2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2135846
Artikelname: KIF2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2135846
Hersteller Artikelnummer: orb2135846
Alternativnummer: BYT-ORB2135846-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIF2A
Konjugation: Biotin
Alternative Synonym: HK2, KIF2, CDCBM3
KIF2A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 004511
UniProt: O00139
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL