CD40LG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2135960
| Artikelname: |
CD40LG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2135960 |
| Hersteller Artikelnummer: |
orb2135960 |
| Alternativnummer: |
BYT-ORB2135960-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CD40LG |
| Konjugation: |
Biotin |
| Alternative Synonym: |
IGM, IMD3, TRAP, gp39, CD154, CD40L, HIGM1, T-BAM, TNFSF5, hCD40L |
| CD40LG Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
29kDa |
| NCBI: |
000065 |
| UniProt: |
P29965 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |