ASGR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2135969
Artikelname: ASGR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2135969
Hersteller Artikelnummer: orb2135969
Alternativnummer: BYT-ORB2135969-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASGR2
Konjugation: Biotin
Alternative Synonym: HL-2, HBXBP, ASGPR2, ASGP-R2, CLEC4H2
ASGR2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001172
UniProt: P07307
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV