XK Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2135998
Artikelname: XK Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2135998
Hersteller Artikelnummer: orb2135998
Alternativnummer: BYT-ORB2135998-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XK
Konjugation: FITC
Alternative Synonym: KX, NA, NAC, X1k, XKR1
XK Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 066569
UniProt: P51811
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKE