PARP6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136053
Artikelname: PARP6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136053
Hersteller Artikelnummer: orb2136053
Alternativnummer: BYT-ORB2136053-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PARP6
Konjugation: Biotin
Alternative Synonym: ARTD17, pART17, PARP-6-C, PARP-6-B1
PARP6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 064599
UniProt: Q9HAF3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNK