PARP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136062
Artikelname: PARP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136062
Hersteller Artikelnummer: orb2136062
Alternativnummer: BYT-ORB2136062-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PARP2
Konjugation: Biotin
Alternative Synonym: ARTD2, ADPRT2, PARP-2, ADPRTL2, ADPRTL3, pADPRT-2
PARP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 005475
UniProt: Q9UGN5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA