TBX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136110
Artikelname: TBX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136110
Hersteller Artikelnummer: orb2136110
Alternativnummer: BYT-ORB2136110-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBX4
Konjugation: Biotin
Alternative Synonym: SPS, ICPPS, PAPPAS
TBX4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 060958
UniProt: P57082
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQALQHYQHE