NR1D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136206
Artikelname: NR1D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136206
Hersteller Artikelnummer: orb2136206
Alternativnummer: BYT-ORB2136206-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NR1D2
Konjugation: Biotin
Alternative Synonym: RVR, BD73, EAR-1R, REVERBB, REVERBbeta
NR1D2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 005117
UniProt: Q14995
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFT