LHX3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2136235
| Artikelname: |
LHX3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2136235 |
| Hersteller Artikelnummer: |
orb2136235 |
| Alternativnummer: |
BYT-ORB2136235-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human LHX3 |
| Konjugation: |
FITC |
| Alternative Synonym: |
LIM3, CPHD3, M2-LHX3 |
| LHX3 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
44kDa |
| NCBI: |
055379 |
| UniProt: |
Q9UBR4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: RLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVR |