LHX3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2136235
Artikelname: LHX3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2136235
Hersteller Artikelnummer: orb2136235
Alternativnummer: BYT-ORB2136235-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LHX3
Konjugation: FITC
Alternative Synonym: LIM3, CPHD3, M2-LHX3
LHX3 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 055379
UniProt: Q9UBR4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVR