CLDN15 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2136247
| Artikelname: |
CLDN15 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2136247 |
| Hersteller Artikelnummer: |
orb2136247 |
| Alternativnummer: |
BYT-ORB2136247-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN15 |
| Konjugation: |
FITC |
| CLDN15 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
24kDa |
| NCBI: |
055158 |
| UniProt: |
P56746 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV |
