ZNF426 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136380
Artikelname: ZNF426 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136380
Hersteller Artikelnummer: orb2136380
Alternativnummer: BYT-ORB2136380-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF426
Konjugation: Biotin
Alternative Synonym: K-RBP
ZNF426 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 077011
UniProt: Q9BUY5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS