RPS16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136434
Artikelname: RPS16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136434
Hersteller Artikelnummer: orb2136434
Alternativnummer: BYT-ORB2136434-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS16
Konjugation: Biotin
Alternative Synonym: S16
RPS16 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 001011
UniProt: Q8N7E9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC