SUFU Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2138052
Artikelname: SUFU Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2138052
Hersteller Artikelnummer: orb2138052
Alternativnummer: BYT-ORB2138052-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUFU
Konjugation: Biotin
Alternative Synonym: SUFUH, JBTS32, SUFUXL, PRO1280
SUFU Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 057253
UniProt: Q9UMX1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGS