ZNF398 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2138253
Artikelname: ZNF398 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2138253
Hersteller Artikelnummer: orb2138253
Alternativnummer: BYT-ORB2138253-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF398
Konjugation: Biotin
Alternative Synonym: P51, P71, ZER6
ZNF398 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 065832
UniProt: B4E377
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC