ARID3A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2138493
Artikelname: ARID3A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2138493
Hersteller Artikelnummer: orb2138493
Alternativnummer: BYT-ORB2138493-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARID3A
Konjugation: FITC
Alternative Synonym: DRIL1, DRIL3, BRIGHT, E2FBP1
ARID3A Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 005215
UniProt: Q99856
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG