MORF4L1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2138627
Artikelname: MORF4L1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2138627
Hersteller Artikelnummer: orb2138627
Alternativnummer: BYT-ORB2138627-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MORF4L1
Konjugation: Biotin
Alternative Synonym: Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15
MORF4L1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 40kDa
UniProt: Q86YT7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ