NOTCH4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2139026
Artikelname: NOTCH4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2139026
Hersteller Artikelnummer: orb2139026
Alternativnummer: BYT-ORB2139026-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOTCH4
Konjugation: Biotin
Alternative Synonym: INT3
NOTCH4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
UniProt: Q99466
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLEGAGPPEARHKATPG