NOTCH2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2139032
Artikelname: NOTCH2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2139032
Hersteller Artikelnummer: orb2139032
Alternativnummer: BYT-ORB2139032-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOTCH2
Konjugation: Biotin
Alternative Synonym: hN2, AGS2, HJCYS
NOTCH2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 077719
UniProt: Q04721
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQW