NFKB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2139051
| Artikelname: |
NFKB2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2139051 |
| Hersteller Artikelnummer: |
orb2139051 |
| Alternativnummer: |
BYT-ORB2139051-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human NFKB2 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
p52, p100, H2TF1, LYT10, CVID10, LYT-10, NF-kB2, p49/p100 |
| NFKB2 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
101kDa |
| NCBI: |
002493 |
| UniProt: |
Q00653 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQC |
