NFIA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2139075
Artikelname: NFIA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2139075
Hersteller Artikelnummer: orb2139075
Alternativnummer: BYT-ORB2139075-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFIA
Konjugation: Biotin
Alternative Synonym: CTF, NF1-A, NFI-A, NFI-L, BRMUTD, NF-I/A
NFIA Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 005586
UniProt: Q8TA97
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLK