AIRE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2139327
Artikelname: AIRE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2139327
Hersteller Artikelnummer: orb2139327
Alternativnummer: BYT-ORB2139327-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AIRE
Konjugation: Biotin
Alternative Synonym: APS1, APSI, PGA1, AIRE1, APECED
AIRE Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 000374
UniProt: O43918
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL