NOCT Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2139753
Artikelname: NOCT Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2139753
Hersteller Artikelnummer: orb2139753
Alternativnummer: BYT-ORB2139753-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L
Konjugation: HRP
Alternative Synonym: NOC, CCR4L, Ccr4c, CCRN4L
NOCT Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 036250
UniProt: Q9UK39
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD