ZNF776 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2139789
Artikelname: ZNF776 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2139789
Hersteller Artikelnummer: orb2139789
Alternativnummer: BYT-ORB2139789-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF776
Konjugation: Biotin
Alternative Synonym: ZNF776,
ZNF776 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 775903
UniProt: Q68DI1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG