PATZ1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139837
Artikelname: PATZ1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139837
Hersteller Artikelnummer: orb2139837
Alternativnummer: BYT-ORB2139837-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PATZ1
Konjugation: FITC
Alternative Synonym: ZSG, MAZR, PATZ, RIAZ, ZBTB19, ZNF278, dJ400N23
PATZ1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 74kDa
NCBI: 055138
UniProt: Q9HBE1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KNGGRFCDVLLRVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGP