FOSB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139843
Artikelname: FOSB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139843
Hersteller Artikelnummer: orb2139843
Alternativnummer: BYT-ORB2139843-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FOSB
Konjugation: FITC
Alternative Synonym: AP-1, G0S3, GOS3, GOSB
FOSB Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 006723
UniProt: P53539
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVL