FOS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2139854
Artikelname: FOS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2139854
Hersteller Artikelnummer: orb2139854
Alternativnummer: BYT-ORB2139854-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOS
Konjugation: HRP
Alternative Synonym: p55, AP-1, C-FOS
FOS Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 005243
UniProt: P01100
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA