ZC3H7B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2139886
Artikelname: ZC3H7B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2139886
Hersteller Artikelnummer: orb2139886
Alternativnummer: BYT-ORB2139886-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZC3H7B
Konjugation: HRP
Alternative Synonym: RoXaN, ROXAN1
ZC3H7B Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 110kDa
NCBI: 060060
UniProt: Q9UGR2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: YECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSN