ZC3H7B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139888
Artikelname: ZC3H7B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139888
Hersteller Artikelnummer: orb2139888
Alternativnummer: BYT-ORB2139888-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZC3H7B
Konjugation: FITC
Alternative Synonym: RoXaN, ROXAN1
ZC3H7B Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 110kDa
NCBI: 060060
UniProt: Q9UGR2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSN