HTATIP Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139928
Artikelname: HTATIP Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139928
Hersteller Artikelnummer: orb2139928
Alternativnummer: BYT-ORB2139928-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTATIP
Konjugation: FITC
Alternative Synonym: TIP, ESA1, PLIP, TIP60, cPLA2, HTATIP, ZC2HC5, HTATIP1, NEDFASB
HTATIP Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 874369
UniProt: C9JL99
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE