NCOA3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2139930
| Artikelname: |
NCOA3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2139930 |
| Hersteller Artikelnummer: |
orb2139930 |
| Alternativnummer: |
BYT-ORB2139930-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human NCOA3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
ACTR, AIB1, RAC3, SRC3, pCIP, AIB-1, CTG26, SRC-3, CAGH16, KAT13B, TNRC14, TNRC16, TRAM-1, bHLHe42 |
| NCOA3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
155kDa |
| NCBI: |
006525 |
| UniProt: |
Q0VF45 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLL |