SIN3A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139960
Artikelname: SIN3A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139960
Hersteller Artikelnummer: orb2139960
Alternativnummer: BYT-ORB2139960-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIN3A
Konjugation: FITC
Alternative Synonym: WITKOS
SIN3A Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 145kDa
NCBI: 056292
UniProt: Q96ST3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSA