OPTN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2140804
Artikelname: OPTN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2140804
Hersteller Artikelnummer: orb2140804
Alternativnummer: BYT-ORB2140804-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OPTN
Konjugation: Biotin
Alternative Synonym: NRP, FIP2, HIP7, HYPL, ALS12, GLC1E, TFIIIA-INTP
OPTN Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 001008214
UniProt: Q96CV9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS