AHR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2140971
Artikelname: AHR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2140971
Hersteller Artikelnummer: orb2140971
Alternativnummer: BYT-ORB2140971-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AHR
Konjugation: Biotin
Alternative Synonym: RP85, bHLHe76
AHR Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 96kDa
NCBI: 001612
UniProt: P35869
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL