EGR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2140978
| Artikelname: |
EGR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2140978 |
| Hersteller Artikelnummer: |
orb2140978 |
| Alternativnummer: |
BYT-ORB2140978-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human EGR1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268 |
| EGR1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
57kDa |
| NCBI: |
001955 |
| UniProt: |
P18146 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS |