FOXL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2142545
Artikelname: FOXL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2142545
Hersteller Artikelnummer: orb2142545
Alternativnummer: BYT-ORB2142545-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXL1
Konjugation: Biotin
Alternative Synonym: FKH6, FKHL11, FREAC7
FOXL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 005241
UniProt: Q12952
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPP