DHRSX Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2142715
Artikelname: DHRSX Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2142715
Hersteller Artikelnummer: orb2142715
Alternativnummer: BYT-ORB2142715-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DHRSX
Konjugation: Biotin
Alternative Synonym: DHRSY, DHRS5X, DHRS5Y, DHRSXY, SDR7C6, CXorf11, SDR46C1
DHRSX Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 660160
UniProt: Q8N5I4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSC