SLC34A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2142948
Artikelname: SLC34A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2142948
Hersteller Artikelnummer: orb2142948
Alternativnummer: BYT-ORB2142948-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC34A3
Konjugation: Biotin
Alternative Synonym: HHRH, NPTIIc
SLC34A3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 543153
UniProt: Q8N130
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL