ZBTB8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2142993
Artikelname: ZBTB8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2142993
Hersteller Artikelnummer: orb2142993
Alternativnummer: BYT-ORB2142993-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human ZBTB8
Konjugation: Biotin
Alternative Synonym: BOZF1, FLJ90065, MGC17919
ZBTB8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 001139192
UniProt: Q8NAP8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDND