PPARGC1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2143133
| Artikelname: |
PPARGC1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2143133 |
| Hersteller Artikelnummer: |
orb2143133 |
| Alternativnummer: |
BYT-ORB2143133-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IF, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A |
| Konjugation: |
Biotin |
| Alternative Synonym: |
LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PGC-1(alpha) |
| PPARGC1A Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
91kDa |
| NCBI: |
037393 |
| UniProt: |
Q9UBK2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL |
