SLC30A9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2143196
Artikelname: SLC30A9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2143196
Hersteller Artikelnummer: orb2143196
Alternativnummer: BYT-ORB2143196-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC30A9
Konjugation: Biotin
Alternative Synonym: HUEL, ZNT9, GAC63, C4orf1, BILAPES
SLC30A9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 006336
UniProt: Q9Y6R2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR