TFAM Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2143481
Artikelname: TFAM Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2143481
Hersteller Artikelnummer: orb2143481
Alternativnummer: BYT-ORB2143481-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
Konjugation: HRP
Alternative Synonym: TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15
TFAM Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 003192
UniProt: Q00059
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS