Arnt Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2144037
| Artikelname: |
Arnt Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2144037 |
| Hersteller Artikelnummer: |
orb2144037 |
| Alternativnummer: |
BYT-ORB2144037-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Drnt, Hif1, ESTM4, Hif1b, bHLHe, ESTM42, W08714, bHLHe2, D3Ertd557, mKIAA4051, D3Ertd557e |
| Arnt Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
85kDa |
| NCBI: |
033839 |
| UniProt: |
Q3ULM2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DEVEVNTKFLRCDDDQMCNDKERFARENHSEIERRRRNKMTAYITELSDM |
