Arnt Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2144037
Artikelname: Arnt Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2144037
Hersteller Artikelnummer: orb2144037
Alternativnummer: BYT-ORB2144037-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Biotin
Alternative Synonym: Drnt, Hif1, ESTM4, Hif1b, bHLHe, ESTM42, W08714, bHLHe2, D3Ertd557, mKIAA4051, D3Ertd557e
Arnt Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 033839
UniProt: Q3ULM2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DEVEVNTKFLRCDDDQMCNDKERFARENHSEIERRRRNKMTAYITELSDM