NDUFS3 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2252612
| Artikelname: |
NDUFS3 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2252612 |
| Hersteller Artikelnummer: |
orb2252612 |
| Alternativnummer: |
BYT-ORB2252612-25 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse NDUFS3 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CI-30kD, 0610010M09Rik |
| NDUFS3 Antibody - C-terminal region |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
28 kDa |
| NCBI: |
080964 |
| UniProt: |
Q9DCT2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: YDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKP |
