ARPC2 Antibody - middle region, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2252614
Artikelname: ARPC2 Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2252614
Hersteller Artikelnummer: orb2252614
Alternativnummer: BYT-ORB2252614-25
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse ARPC2
Konjugation: Unconjugated
Alternative Synonym: p34-, 34kDa, p34-Arc, 2210023N03Rik
ARPC2 Antibody - middle region
Klonalität: Polyclonal
Molekulargewicht: 33 kDa
NCBI: 083987
UniProt: Q9CVB6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRA