ARPC2 Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2252614
Artikelname: |
ARPC2 Antibody - middle region, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2252614 |
Hersteller Artikelnummer: |
orb2252614 |
Alternativnummer: |
BYT-ORB2252614-25 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse ARPC2 |
Konjugation: |
Unconjugated |
Alternative Synonym: |
p34-, 34kDa, p34-Arc, 2210023N03Rik |
ARPC2 Antibody - middle region |
Klonalität: |
Polyclonal |
Molekulargewicht: |
33 kDa |
NCBI: |
083987 |
UniProt: |
Q9CVB6 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: AVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRA |