CLEC7A Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2252615
Artikelname: CLEC7A Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2252615
Hersteller Artikelnummer: orb2252615
Alternativnummer: BYT-ORB2252615-25
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse CLEC7A
Konjugation: Unconjugated
Alternative Synonym: BG, BGR, beta-, Clecsf, dectin, beta-GR, Clecsf12
CLEC7A Antibody - N-terminal region
Klonalität: Polyclonal
Molekulargewicht: 26 kDa
UniProt: Q6QLQ4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SHIENLDEDGYTQLDFSTQDIHKRPRGSEKGSQAPSSPWRPIAVGLGILC