DNM1L Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2252618
| Artikelname: |
DNM1L Antibody - middle region, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2252618 |
| Hersteller Artikelnummer: |
orb2252618 |
| Alternativnummer: |
BYT-ORB2252618-25 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse DNM1L |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Dr, Dnm, pyt, Dlp1, Drp1, Dnmlp1, python, AI450666, 6330417M19Rik |
| DNM1L Antibody - middle region |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
81 kDa |
| NCBI: |
001021118 |
| UniProt: |
Q8K1M6 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: IPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKY |
