SNAPIN Antibody - middlel region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2252619
| Artikelname: |
SNAPIN Antibody - middlel region, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2252619 |
| Hersteller Artikelnummer: |
orb2252619 |
| Alternativnummer: |
BYT-ORB2252619-25 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse SNAPIN |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Sna, Bloc, 25kDa, Snapap, Bloc1s7, AA407989, AV026596, Snap25bp |
| SNAPIN Antibody - middlel region |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
14 kDa |
| NCBI: |
598615 |
| UniProt: |
Q9Z266 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPS |
