SCO1 Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2252620
| Artikelname: |
SCO1 Antibody - middle region, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2252620 |
| Hersteller Artikelnummer: |
orb2252620 |
| Alternativnummer: |
BYT-ORB2252620-25 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse SCO1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
D11Bwg1310e, 2610001C07Rik |
| SCO1 Antibody - middle region |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
32 kDa |
| NCBI: |
001035115 |
| UniProt: |
Q5SUC9 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: IATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTI |
